PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Neem_21164_f_1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
Family HD-ZIP
Protein Properties Length: 235aa    MW: 27155.6 Da    PI: 9.3238
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Neem_21164_f_1genomeNGDView Nucleic Acid
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox59.45.9e-192071556
                    SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
        Homeobox  5 ttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56
                     ++t++q++ Le+ F +n+++++e +++LA++lg+  rqV vW+qN+Ra++k
  Neem_21164_f_1 20 KRLTQDQVRLLERSFTSNKKLDTELKQKLANQLGVAPRQVAVWYQNKRARWK 71
                    569************************************************9 PP

2Homeobox20.77e-07961123956
                     S-HHHHHHHHHHHHHHHH CS
        Homeobox  39 LterqVkvWFqNrRakek 56 
                     L e++V vW+qN+Ra++k
  Neem_21164_f_1  96 L-EKDVAVWYQNKRARWK 112
                     5.679************9 PP

3HD-ZIP_I/II97.99.6e-3219100384
     HD-ZIP_I/II   3 krrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekev 84 
                     k+rl+++qv+lLE+sF++++kL++e K++la++Lg+ prqvavW+qn+RAR+kt+ lE dy+a++ ++++  +e++rLek+v
  Neem_21164_f_1  19 KKRLTQDQVRLLERSFTSNKKLDTELKQKLANQLGVAPRQVAVWYQNKRARWKTQSLELDYNAIQVKLENALAEKRRLEKDV 100
                     99*****************************************************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007115.7911373IPR001356Homeobox domain
SMARTSM003893.3E-151577IPR001356Homeobox domain
SuperFamilySSF466892.57E-161881IPR009057Homeodomain-like
CDDcd000861.38E-121974No hitNo description
PfamPF000463.0E-162071IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.602.6E-182180IPR009057Homeodomain-like
PROSITE patternPS0002704871IPR017970Homeobox, conserved site
Gene3DG3DSA:1.10.10.601.1E-597121IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 235 aa     Download sequence    Send to blast
MDIFNSLQDQ KHPQKFHGKK RLTQDQVRLL ERSFTSNKKL DTELKQKLAN QLGVAPRQVA  60
VWYQNKRARW KTQSLELDYN AIQVKLENAL AEKRRLEKDV AVWYQNKRAR WKTQSLELDY  120
NAIQVKLENA LAEKRRLEKD VKQLREELRR AQQMLFALSN QKAVETNIST TVVSCNNYST  180
ATSCSDQKGH CSSFSSLLQE DYVHGGDHDH HDDQALQIDH ELYACLIGAG GSAWG
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006464812.14e-81PREDICTED: homeobox-leucine zipper protein ATHB-52
RefseqXP_006451774.14e-81hypothetical protein CICLE_v10009522mg
TrEMBLV4WEM74e-81V4WEM7_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121072632
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53980.11e-28homeobox protein 52